Home  >  Products  >  anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (Middle Region) antibody
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (Middle Region) antibody

anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (Middle Region) antibody

Cat no: ABIN406440

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (Middle Region) antibody: This is a rabbit polyclonal antibody against DDAH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406440
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 114455,380577,378898,23576,537391,69219,64157
Concentration: 1 mg/mL
Antigen: DDAH1
Clonality: Polyclonal
Sequence: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTN QRGAEILADT
Molecular weight: 31 kDa
Entrez gene: 114455,380577,378898,23576,537391,69219,64157

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave