Home  >  Products  >  anti-Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody
anti-Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody

anti-Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody

Cat no: ABIN406364

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody: This is a rabbit polyclonal antibody against DNALI1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406364
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7802,482473,529053,75563,298524
Concentration: 1 mg/mL
Antigen: DNALI1
Clonality: Polyclonal
Sequence: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVS RNTEKRSPKA
Molecular weight: 31 kDa
Entrez gene: 7802,482473,529053,75563,298524

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave