Home  >  Products  >  anti-Echinoderm Microtubule Associated Protein Like 1 (EML1) (C-Term) antibody
anti-Echinoderm Microtubule Associated Protein Like 1 (EML1) (C-Term) antibody

anti-Echinoderm Microtubule Associated Protein Like 1 (EML1) (C-Term) antibody

Cat no: ABIN503261

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Echinoderm Microtubule Associated Protein Like 1 (EML1) (C-Term) antibody: This is a rabbit polyclonal antibody against EML1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503261
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 767643,495344,423452,2009,490853,512904,68519,362783
Concentration: 1 mg/mL
Antigen: EML1
Clonality: Polyclonal
Sequence: YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDT SIMQWRVI
Molecular weight: 92 kDa
Entrez gene: 767643,495344,423452,2009,490853,512904,68519,362783

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave