Home  >  Products  >  anti-Endothelial Differentiation Related Factor 1 (EDF1) (N-Term) antibody

anti-Endothelial Differentiation Related Factor 1 (EDF1) (N-Term) antibody

Cat no: ABIN501446


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Endothelial Differentiation Related Factor 1 (EDF1) (N-Term) antibody: This is a rabbit polyclonal antibody against EDF1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501446
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 793036,734824,417286,8721,480674,515380,59022,296570
Concentration: 1 mg/mL
Antigen: EDF1
Clonality: Polyclonal
Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNK
Molecular weight: 16 kDa
Entrez gene: 793036,734824,417286,8721,480674,515380,59022,296570

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave