Home  >  Products  >  anti-Enhancer of Zeste Homolog 1 (Drosophila) (EZH1) (N-Term) antibody

anti-Enhancer of Zeste Homolog 1 (Drosophila) (EZH1) (N-Term) antibody

Cat no: ABIN501639


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Enhancer of Zeste Homolog 1 (Drosophila) (EZH1) (N-Term) antibody: This is a rabbit polyclonal antibody against EZH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501639
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 664754,399174,420023,2145,480516,533087,14055,303547
Concentration: 1 mg/mL
Antigen: EZH1
Clonality: Polyclonal
Sequence: MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKA LYVANFAKVQ
Molecular weight: 85 kDa
Entrez gene: 664754,399174,420023,2145,480516,533087,14055,303547

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave