Home  >  Products  >  anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (C-Term) antibody
anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (C-Term) antibody

anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (C-Term) antibody

Cat no: ABIN310716

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (C-Term) antibody: This is a rabbit polyclonal antibody against ECHS1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310716
Reactivities: Human, Mouse, Rat, Bovine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 733431,1892,281748,93747,140547
Concentration: 1 mg/mL
Antigen: ECHS1
Clonality: Polyclonal
Sequence: KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFV EKRKANFKDQ
Molecular weight: 28 kDa
Entrez gene: 733431,1892,281748,93747,140547

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave