Home  >  Products  >  anti-ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1) (N-Term) antibody

anti-ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1) (N-Term) antibody

Cat no: ABIN502799


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1) (N-Term) antibody: This is a rabbit polyclonal antibody against EDEM1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502799
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100049149,416110,9695,511008,192193,297504
Concentration: 1 mg/mL
Antigen: EDEM1
Clonality: Polyclonal
Sequence: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLT LVDALDTLAI
Molecular weight: 74 kDa
Entrez gene: 100049149,416110,9695,511008,192193,297504

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave