Home  >  Products  >  anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) (C-Term) antibody
anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) (C-Term) antibody

anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) (C-Term) antibody

Cat no: ABIN183993

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) (C-Term) antibody: This is a rabbit polyclonal antibody against ERAL1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183993
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100127247,26284,480629,523344,57837,363646
Concentration: 1 mg/mL
Antigen: ERAL1
Clonality: Polyclonal
Sequence: KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQ IAQEAGHDLM
Molecular weight: 48 kDa
Entrez gene: 100127247,26284,480629,523344,57837,363646

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave