Home  >  Products  >  anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (C-Term) antibody

anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (C-Term) antibody

Cat no: ABIN486848


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (C-Term) antibody: This is a rabbit polyclonal antibody against ERCC8. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN486848
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q13216
Gene: 1161
Concentration: 1 mg/mL
Antigen: ERCC8
Clonality: Polyclonal
Sequence: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFE DAWSSSDEEG
Molecular weight: 44 kDa
Entrez gene: 1161

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave