Home  >  Products  >  anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (N-Term) antibody
anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (N-Term) antibody

anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (N-Term) antibody

Cat no: ABIN406639

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (N-Term) antibody: This is a rabbit polyclonal antibody against ERCC8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406639
Reactivities: Human, Mouse, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 1161,487225,518857,71991
Concentration: 1 mg/mL
Antigen: ERCC8
Clonality: Polyclonal
Sequence: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHD TGMFTSSSFD
Molecular weight: 44 kDa
Entrez gene: 1161,487225,518857,71991

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave