Home  >  Products  >  anti-F-Box and WD Repeat Domain Containing 10 (FBXW10) (Middle Region) antibody

anti-F-Box and WD Repeat Domain Containing 10 (FBXW10) (Middle Region) antibody

Cat no: ABIN503341


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-F-Box and WD Repeat Domain Containing 10 (FBXW10) (Middle Region) antibody: This is a rabbit polyclonal antibody against FBXW10. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503341
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 10517,479512,213980,303215
Concentration: 1 mg/mL
Antigen: FBXW10
Clonality: Polyclonal
Sequence: RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSG SYDLSIRYWD
Molecular weight: 120 kDa
Entrez gene: 10517,479512,213980,303215

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave