Home  >  Products  >  anti-Family with Sequence Similarity 189, Member B (FAM189B) (N-Term) antibody
anti-Family with Sequence Similarity 189, Member B (FAM189B) (N-Term) antibody

anti-Family with Sequence Similarity 189, Member B (FAM189B) (N-Term) antibody

Cat no: ABIN404965

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Family with Sequence Similarity 189, Member B (FAM189B) (N-Term) antibody: This is a rabbit polyclonal antibody against C1orf2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404965
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: P81408
Gene: 10712
Concentration: 1 mg/mL
Antigen: C1orf2
Clonality: Polyclonal
Sequence: PLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTI CAAIICTLSA
Molecular weight: 71 kDa
Entrez gene: 10712

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave