Home  >  Products  >  anti-Far Upstream Element (FUSE) Binding Protein 3 (FUBP3) (Middle Region) antibody

anti-Far Upstream Element (FUSE) Binding Protein 3 (FUBP3) (Middle Region) antibody

Cat no: ABIN406178


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Far Upstream Element (FUSE) Binding Protein 3 (FUBP3) (Middle Region) antibody: This is a rabbit polyclonal antibody against FUBP3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406178
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 8939,541080,320267,362106
Concentration: 1 mg/mL
Antigen: FUBP3
Clonality: Polyclonal
Sequence: PSQQSQPQSSQPNYSKAWEDYYKKQSHAASAAPQASSPPD YTMAWAEYYR
Molecular weight: 62 kDa
Entrez gene: 8939,541080,320267,362106

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave