Home  >  Products  >  anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (C-Term) antibody
anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (C-Term) antibody

anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (C-Term) antibody

Cat no: ABIN184143

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Fas (TNFRSF6)-Associated Via Death Domain (FADD) (C-Term) antibody: This is a rabbit polyclonal antibody against FADD. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN184143
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q13158
Gene: 8772
Concentration: 1 mg/mL
Antigen: FADD
Clonality: Polyclonal
Sequence: AHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSW NSDASTSEAS
Molecular weight: 23 kDa
Entrez gene: 8772

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave