Home  >  Products  >  anti-G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A) (C-Term) antibody
anti-G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A) (C-Term) antibody

anti-G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A) (C-Term) antibody

Cat no: ABIN310171

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A) (C-Term) antibody: This is a rabbit polyclonal antibody against GPCR5A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310171
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q8NFJ5
Gene: 9052
Concentration: 1 mg/mL
Antigen: GPCR5A
Clonality: Polyclonal
Sequence: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRA HAWPSPYKDY
Molecular weight: 39 kDa
Entrez gene: 9052

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave