Home  >  Products  >  anti-G Protein Pathway Suppressor 1 (GPS1) (N-Term) antibody
anti-G Protein Pathway Suppressor 1 (GPS1) (N-Term) antibody

anti-G Protein Pathway Suppressor 1 (GPS1) (N-Term) antibody

Cat no: ABIN504402

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-G Protein Pathway Suppressor 1 (GPS1) (N-Term) antibody: This is a rabbit polyclonal antibody against GPS1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504402
Reactivities: Human, Mouse, Bovine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 777711,431842,417382,2873,525572,209318
Concentration: 1 mg/mL
Antigen: GPS1
Clonality: Polyclonal
Sequence: PLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPS LDLEQYAASY
Molecular weight: 55 kDa
Entrez gene: 777711,431842,417382,2873,525572,209318

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave