Home  >  Products  >  anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1) (Middle Region) antibody
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1) (Middle Region) antibody

anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1) (Middle Region) antibody

Cat no: ABIN501360

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1) (Middle Region) antibody: This is a rabbit polyclonal antibody against GABRA1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501360
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 768183,100653509,374214,2554,489143,780973,14394,29705
Concentration: 1 mg/mL
Antigen: GABRA1
Clonality: Polyclonal
Sequence: YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQT YLPCIMTVIL
Molecular weight: 52 kDa
Entrez gene: 768183,100653509,374214,2554,489143,780973,14394,29705

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave