Home  >  Products  >  anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3) (Middle Region) antibody
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3) (Middle Region) antibody

anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3) (Middle Region) antibody

Cat no: ABIN183120

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3) (Middle Region) antibody: This is a rabbit polyclonal antibody against GABRA3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183120
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100653496,2556,492223,282237,14396,24947
Concentration: 1 mg/mL
Antigen: GABRA3
Clonality: Polyclonal
Sequence: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIR SSTGEYVVMT
Molecular weight: 55 kDa
Entrez gene: 100653496,2556,492223,282237,14396,24947

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave