Home  >  Products  >  anti-gamma-aminobutyric Acid (GABA) A Receptor, gamma 3 (GABRG3) (N-Term) antibody
anti-gamma-aminobutyric Acid (GABA) A Receptor, gamma 3 (GABRG3) (N-Term) antibody

anti-gamma-aminobutyric Acid (GABA) A Receptor, gamma 3 (GABRG3) (N-Term) antibody

Cat no: ABIN184256

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-gamma-aminobutyric Acid (GABA) A Receptor, gamma 3 (GABRG3) (N-Term) antibody: This is a rabbit polyclonal antibody against GABRG3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184256
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Drosophila/Arthropod
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 770097,2567,488685,14407,79211
Concentration: 1 mg/mL
Antigen: GABRG3
Clonality: Polyclonal
Sequence: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKL LREYDKKLRP
Molecular weight: 54 kDa
Entrez gene: 770097,2567,488685,14407,79211

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave