Home  >  Products  >  anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody
anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody

anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody

Cat no: ABIN310187

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody: This is a rabbit polyclonal antibody against GGTLA4. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310187
Reactivities: Human, Mouse, Rat, Canine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Accession: Q9BX51
Gene: 92086
Concentration: 1 mg/mL
Antigen: GGTLA4
Clonality: Polyclonal
Sequence: DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASD SRKGGEPAGY
Molecular weight: 25 kDa
Entrez gene: 92086

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave