Home  >  Products  >  anti-Gap Junction Protein, beta 6, 30kDa (GJB6) (Middle Region) antibody

anti-Gap Junction Protein, beta 6, 30kDa (GJB6) (Middle Region) antibody

Cat no: ABIN501574


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Gap Junction Protein, beta 6, 30kDa (GJB6) (Middle Region) antibody: This is a rabbit polyclonal antibody against GJB6. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501574
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 10804,508454,14623,84403
Concentration: 1 mg/mL
Antigen: GJB6
Clonality: Polyclonal
Sequence: CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISD SGQNAITGFP
Molecular weight: 30 kDa
Entrez gene: 10804,508454,14623,84403

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave