Home  >  Products  >  anti-GATA Zinc Finger Domain Containing 1 (GATAD1) (Middle Region) antibody

anti-GATA Zinc Finger Domain Containing 1 (GATAD1) (Middle Region) antibody

Cat no: ABIN404858


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-GATA Zinc Finger Domain Containing 1 (GATAD1) (Middle Region) antibody: This is a rabbit polyclonal antibody against GATAD1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404858
Reactivities: Human, Mouse, Rat, Bovine, Canine, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 678617,380295,57798,482301,784921,67210,500005
Concentration: 1 mg/mL
Antigen: GATAD1
Clonality: Polyclonal
Sequence: EKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYL EFVCHAPSEY
Molecular weight: 29 kDa
Entrez gene: 678617,380295,57798,482301,784921,67210,500005

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave