Home  >  Products  >  anti-GC-Rich Sequence DNA-Binding Factor 1 (GCFC1) (N-Term) antibody
anti-GC-Rich Sequence DNA-Binding Factor 1 (GCFC1) (N-Term) antibody

anti-GC-Rich Sequence DNA-Binding Factor 1 (GCFC1) (N-Term) antibody

Cat no: ABIN405932

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-GC-Rich Sequence DNA-Binding Factor 1 (GCFC1) (N-Term) antibody: This is a rabbit polyclonal antibody against C21orf66. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405932
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734557,418499,94104,67367
Concentration: 1 mg/mL
Antigen: C21orf66
Clonality: Polyclonal
Sequence: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVR EDENDASDDE
Molecular weight: 93 kDa
Entrez gene: 734557,418499,94104,67367

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave