Home  >  Products  >  anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) (N-Term) antibody

anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) (N-Term) antibody

Cat no: ABIN184235


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) (N-Term) antibody: This is a rabbit polyclonal antibody against GRIA2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184235
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100294514,414894,2891,614283,14800,29627
Concentration: 1 mg/mL
Antigen: GRIA2
Clonality: Polyclonal
Sequence: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGF YDKKSVNTIT
Molecular weight: 99 kDa
Entrez gene: 100294514,414894,2891,614283,14800,29627

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave