Home  >  Products  >  anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (N-Term) antibody
anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (N-Term) antibody

anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (N-Term) antibody

Cat no: ABIN309938

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-GTF2I Repeat Domain Containing 1 (GTF2IRD1) (N-Term) antibody: This is a rabbit polyclonal antibody against GTF2IRD1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN309938
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 9569,489796,507792
Concentration: 1 mg/mL
Antigen: GTF2IRD1
Clonality: Polyclonal
Sequence: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDS MCSALSKLNA
Molecular weight: 106 kDa
Entrez gene: 9569,489796,507792

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave