Home  >  Products  >  anti-Hairy and Enhancer of Split 7 (Drosophila) (HES7) (Middle Region) antibody
anti-Hairy and Enhancer of Split 7 (Drosophila) (HES7) (Middle Region) antibody

anti-Hairy and Enhancer of Split 7 (Drosophila) (HES7) (Middle Region) antibody

Cat no: ABIN182316

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Hairy and Enhancer of Split 7 (Drosophila) (HES7) (Middle Region) antibody: This is a rabbit polyclonal antibody against HES7. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182316
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 84667,612802,617638,84653,287423
Concentration: 1 mg/mL
Antigen: HES7
Clonality: Polyclonal
Sequence: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLR LAAIAHDASP
Molecular weight: 25 kDa
Entrez gene: 84667,612802,617638,84653,287423

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave