Home  >  Products  >  anti-Heat Shock Protein 90kDa beta (Grp94), Member 1 (HSP90B1) (C-Term) antibody
anti-Heat Shock Protein 90kDa beta (Grp94), Member 1 (HSP90B1) (C-Term) antibody

anti-Heat Shock Protein 90kDa beta (Grp94), Member 1 (HSP90B1) (C-Term) antibody

Cat no: ABIN501970

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Heat Shock Protein 90kDa beta (Grp94), Member 1 (HSP90B1) (C-Term) antibody: This is a rabbit polyclonal antibody against HSP90B1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501970
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: P14625
Gene: 7184
Concentration: 1 mg/mL
Antigen: HSP90B1
Clonality: Polyclonal
Sequence: EEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKE STAEKDEL
Molecular weight: 90 kDa
Entrez gene: 7184

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave