Home  >  Products  >  anti-Heat Shock Transcription Factor 2 Binding Protein (HSF2BP) (N-Term) antibody

anti-Heat Shock Transcription Factor 2 Binding Protein (HSF2BP) (N-Term) antibody

Cat no: ABIN501348


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Heat Shock Transcription Factor 2 Binding Protein (HSF2BP) (N-Term) antibody: This is a rabbit polyclonal antibody against HSF2BP. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501348
Reactivities: Human, Mouse, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 11077,617142,74377
Concentration: 1 mg/mL
Antigen: HSF2BP
Clonality: Polyclonal
Sequence: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQ QLLQQAEYCT
Molecular weight: 38 kDa
Entrez gene: 11077,617142,74377

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave