Home  >  Products  >  anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody
anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody

anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody

Cat no: ABIN502766

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody: This is a rabbit polyclonal antibody against HS3ST3B1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502766
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9953,489516,617069
Concentration: 1 mg/mL
Antigen: HS3ST3B1
Clonality: Polyclonal
Sequence: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPAL ATAPDGTPPR
Molecular weight: 43 kDa
Entrez gene: 9953,489516,617069

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave