Home  >  Products  >  anti-Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0) (Middle Region) antibody
anti-Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0) (Middle Region) antibody

anti-Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0) (Middle Region) antibody

Cat no: ABIN184014

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0) (Middle Region) antibody: This is a rabbit polyclonal antibody against HNRPA0. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN184014
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Immunoprecipitation, Western Blot
Size: 100 micro g
Gene: 10949,481524,540311
Concentration: 1 mg/mL
Antigen: HNRPA0
Clonality: Polyclonal
Sequence: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRG GRGGRGRGGG
Molecular weight: 34 kDa
Entrez gene: 10949,481524,540311

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave