Home  >  Products  >  anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody
anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody

anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody

Cat no: ABIN182667

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody: This is a rabbit polyclonal antibody against HTATIP2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182667
Reactivities: Human, Mouse, Rat, Bovine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 64605,734572,10553,539276,53415,292935
Concentration: 1 mg/mL
Antigen: HTATIP2
Clonality: Polyclonal
Sequence: FRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRR KLTFDEEAYK
Molecular weight: 27 kDa
Entrez gene: 64605,734572,10553,539276,53415,292935

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave