Home  >  Products  >  anti-Hydroxysteroid (17-Beta) Dehydrogenase 6 Homolog (Mouse) (HSD17B6) (N-Term) antibody
anti-Hydroxysteroid (17-Beta) Dehydrogenase 6 Homolog (Mouse) (HSD17B6) (N-Term) antibody

anti-Hydroxysteroid (17-Beta) Dehydrogenase 6 Homolog (Mouse) (HSD17B6) (N-Term) antibody

Cat no: ABIN310170

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Hydroxysteroid (17-Beta) Dehydrogenase 6 Homolog (Mouse) (HSD17B6) (N-Term) antibody: This is a rabbit polyclonal antibody against HSD17B6. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310170
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 8630,481118,533086,27400,286964
Concentration: 1 mg/mL
Antigen: HSD17B6
Clonality: Polyclonal
Sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSG FGNLLARQLD
Molecular weight: 35 kDa
Entrez gene: 8630,481118,533086,27400,286964

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave