Home  >  Products  >  anti-Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) (C-Term) antibody
anti-Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) (C-Term) antibody

anti-Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) (C-Term) antibody

Cat no: ABIN504428

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Jumonji C Domain-Containing Histone Demethylase 1 Homolog D (S. Cerevisiae) (JHDM1D) (C-Term) antibody: This is a rabbit polyclonal antibody against JHDM1D. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504428
Reactivities: Human, Mouse
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 80853,338523
Concentration: 1 mg/mL
Antigen: JHDM1D
Clonality: Polyclonal
Sequence: LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVK VIAATNRVDI
Molecular weight: 106 kDa
Entrez gene: 80853,338523

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave