Home  >  Products  >  anti-Kelch Repeat and BTB (POZ) Domain Containing 5 (KBTBD5) (C-Term) antibody
anti-Kelch Repeat and BTB (POZ) Domain Containing 5 (KBTBD5) (C-Term) antibody

anti-Kelch Repeat and BTB (POZ) Domain Containing 5 (KBTBD5) (C-Term) antibody

Cat no: ABIN501890

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Kelch Repeat and BTB (POZ) Domain Containing 5 (KBTBD5) (C-Term) antibody: This is a rabbit polyclonal antibody against KBTBD5. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501890
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 779378,420389,131377,485616,514526,72330,316088
Concentration: 1 mg/mL
Antigen: KBTBD5
Clonality: Polyclonal
Sequence: ELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRL NVLCLTKM
Molecular weight: 69 kDa
Entrez gene: 779378,420389,131377,485616,514526,72330,316088

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave