Home  >  Products  >  anti-KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2) (Middle Region) antibody
anti-KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2) (Middle Region) antibody

anti-KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2) (Middle Region) antibody

Cat no: ABIN503431

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2) (Middle Region) antibody: This is a rabbit polyclonal antibody against KHDRBS2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503431
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 768147,428643,202559,481859,789972,170771,170843
Concentration: 1 mg/mL
Antigen: KHDRBS2
Clonality: Polyclonal
Sequence: EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSE DSGRGRGIRG
Molecular weight: 39 kDa
Entrez gene: 768147,428643,202559,481859,789972,170771,170843

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave