Home  >  Products  >  anti-Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1) (N-Term) antibody

anti-Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1) (N-Term) antibody

Cat no: ABIN502771


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1) (N-Term) antibody: This is a rabbit polyclonal antibody against KLRA1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502771
Reactivities: Human, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 10748,403478,397612,281886
Concentration: 1 mg/mL
Antigen: KLRA1
Clonality: Polyclonal
Sequence: NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFS VPWHLIAVTL
Molecular weight: 25 kDa
Entrez gene: 10748,403478,397612,281886

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave