Home  >  Products  >  anti-KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) antibody
anti-KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) antibody

anti-KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) antibody

Cat no: ABIN405350

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) antibody: This is a rabbit polyclonal antibody against KRR1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405350
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 724049,399412,417863,11103,475405,513714,52705,314830
Concentration: 1 mg/mL
Antigen: KRR1
Clonality: Polyclonal
Sequence: KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPI VKPKEASTET
Molecular weight: 44 kDa
Entrez gene: 724049,399412,417863,11103,475405,513714,52705,314830

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave