Home  >  Products  >  anti-Kv Channel Interacting Protein 2 (KCNIP2) (N-Term) antibody

anti-Kv Channel Interacting Protein 2 (KCNIP2) (N-Term) antibody

Cat no: ABIN183183


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Kv Channel Interacting Protein 2 (KCNIP2) (N-Term) antibody: This is a rabbit polyclonal antibody against KCNIP2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183183
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 779161,374098,30819,403598,540895,100009019,80906,56817
Concentration: 1 mg/mL
Antigen: KCNIP2
Clonality: Polyclonal
Sequence: PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFK QIYSQFFPQG
Molecular weight: 21 kDa
Entrez gene: 779161,374098,30819,403598,540895,100009019,80906,56817

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave