Home  >  Products  >  anti-Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody
anti-Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody

anti-Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody

Cat no: ABIN503093

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody: This is a rabbit polyclonal antibody against LRFN3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503093
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 79414,100688169,767839,233067,308495
Concentration: 1 mg/mL
Antigen: LRFN3
Clonality: Polyclonal
Sequence: VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTA TRPVGCARFS
Molecular weight: 66 kDa
Entrez gene: 79414,100688169,767839,233067,308495

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave