Home  >  Products  >  anti-Lysosomal Protein Transmembrane 4 alpha (LAPTM4A) (Middle Region) antibody

anti-Lysosomal Protein Transmembrane 4 alpha (LAPTM4A) (Middle Region) antibody

Cat no: ABIN310880


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Lysosomal Protein Transmembrane 4 alpha (LAPTM4A) (Middle Region) antibody: This is a rabbit polyclonal antibody against LAPTM4A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310880
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 100003844,496032,421959,9741,475678,404135,100009331,17775,298875
Concentration: 1 mg/mL
Antigen: LAPTM4A
Clonality: Polyclonal
Sequence: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSC LLFIVLVFFA
Molecular weight: 27 kDa
Entrez gene: 100003844,496032,421959,9741,475678,404135,100009331,17775,298875

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave