Home  >  Products  >  anti-Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (N-Term) antibody
anti-Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (N-Term) antibody

anti-Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (N-Term) antibody

Cat no: ABIN405271

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (N-Term) antibody: This is a rabbit polyclonal antibody against MSL3L1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405271
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 10943,491742,515220,17692,317464
Concentration: 1 mg/mL
Antigen: MSL3L1
Clonality: Polyclonal
Sequence: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIV GKDEKGRKIP
Molecular weight: 60 kDa
Entrez gene: 10943,491742,515220,17692,317464

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave