Home  >  Products  >  anti-Membrane-Associated Ring Finger (C3HC4) 7, E3 Ubiquitin Protein Ligase (MARCH7) (Middle Region) antibody
anti-Membrane-Associated Ring Finger (C3HC4) 7, E3 Ubiquitin Protein Ligase (MARCH7) (Middle Region) antibody

anti-Membrane-Associated Ring Finger (C3HC4) 7, E3 Ubiquitin Protein Ligase (MARCH7) (Middle Region) antibody

Cat no: ABIN405546

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Membrane-Associated Ring Finger (C3HC4) 7, E3 Ubiquitin Protein Ligase (MARCH7) (Middle Region) antibody: This is a rabbit polyclonal antibody against MARCH7. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405546
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 733332,424332,64844,507865,57438,311059
Concentration: 1 mg/mL
Antigen: MARCH7
Clonality: Polyclonal
Sequence: SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSR SNVPSASEVP
Molecular weight: 78 kDa
Entrez gene: 733332,424332,64844,507865,57438,311059

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave