Home  >  Products  >  anti-Minichromosome Maintenance Deficient 8 (MCM8) (C-Term) antibody
anti-Minichromosome Maintenance Deficient 8 (MCM8) (C-Term) antibody

anti-Minichromosome Maintenance Deficient 8 (MCM8) (C-Term) antibody

Cat no: ABIN309831

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Minichromosome Maintenance Deficient 8 (MCM8) (C-Term) antibody: This is a rabbit polyclonal antibody against MCM8. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN309831
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 734487,421314,84515,477163,507507,66634,296178
Concentration: 1 mg/mL
Antigen: MCM8
Clonality: Polyclonal
Sequence: IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEF GNLDFERSQH
Molecular weight: 94 kDa
Entrez gene: 734487,421314,84515,477163,507507,66634,296178

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave