Home  >  Products  >  anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 2 (MAPKAPK2) (C-Term) antibody
anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 2 (MAPKAPK2) (C-Term) antibody

anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 2 (MAPKAPK2) (C-Term) antibody

Cat no: ABIN184265

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 2 (MAPKAPK2) (C-Term) antibody: This is a rabbit polyclonal antibody against MAPKAPK2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184265
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Accession: P49137
Gene: 9261
Concentration: 1 mg/mL
Antigen: MAPKAPK2
Clonality: Polyclonal
Sequence: TKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYE QIKIKKIEDA
Molecular weight: 46 kDa
Entrez gene: 9261

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave