Home  >  Products  >  anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (C-Term) antibody

anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (C-Term) antibody

Cat no: ABIN502212


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (C-Term) antibody: This is a rabbit polyclonal antibody against MAP2K3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502212
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 65239,399150,416496,5606,489547,516039,26397,303200
Concentration: 1 mg/mL
Antigen: MAP2K3
Clonality: Polyclonal
Sequence: EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEH PFFTLHKTKK
Molecular weight: 36 kDa
Entrez gene: 65239,399150,416496,5606,489547,516039,26397,303200

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave