Home  >  Products  >  anti-N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15) (Middle Region) antibody

anti-N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15) (Middle Region) antibody

Cat no: ABIN503008


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15) (Middle Region) antibody: This is a rabbit polyclonal antibody against NARG1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503008
Reactivities: Human, Mouse, Rat, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 779106,80155,74838,310399
Concentration: 1 mg/mL
Antigen: NARG1
Clonality: Polyclonal
Sequence: PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPN DDGKEEPPTT
Molecular weight: 101 kDa
Entrez gene: 779106,80155,74838,310399

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave