Home  >  Products  >  anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody
anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody

anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody

Cat no: ABIN311101

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody: This is a rabbit polyclonal antibody against NARG1L. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN311101
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 79612,538989,66897
Concentration: 1 mg/mL
Antigen: NARG1L
Clonality: Polyclonal
Sequence: ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQY SLALDYINAA
Molecular weight: 50 kDa
Entrez gene: 79612,538989,66897

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave