Home  >  Products  >  anti-Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP) (Middle Region) antibody
anti-Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP) (Middle Region) antibody

anti-Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP) (Middle Region) antibody

Cat no: ABIN504344

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP) (Middle Region) antibody: This is a rabbit polyclonal antibody against NASP. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504344
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 799570,424600,4678,475373,512427,100009592,50927,298441
Concentration: 1 mg/mL
Antigen: NASP
Clonality: Polyclonal
Sequence: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNV AELALKATLV
Molecular weight: 49 kDa
Entrez gene: 799570,424600,4678,475373,512427,100009592,50927,298441

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave