Home  >  Products  >  anti-Nuclear Fragile X Mental Retardation Protein Interacting Protein 2 (NUFIP2) (N-Term) antibody

anti-Nuclear Fragile X Mental Retardation Protein Interacting Protein 2 (NUFIP2) (N-Term) antibody

Cat no: ABIN311438


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Nuclear Fragile X Mental Retardation Protein Interacting Protein 2 (NUFIP2) (N-Term) antibody: This is a rabbit polyclonal antibody against NUFIP2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311438
Reactivities: Human, Mouse, Rat, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100037153,57532,68564,681371
Concentration: 1 mg/mL
Antigen: NUFIP2
Clonality: Polyclonal
Sequence: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRK ARRNSAKGCE
Molecular weight: 76 kDa
Entrez gene: 100037153,57532,68564,681371

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave