Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group D, Member 2 (NR1D2) (N-Term) antibody

anti-Nuclear Receptor Subfamily 1, Group D, Member 2 (NR1D2) (N-Term) antibody

Cat no: ABIN309901


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Nuclear Receptor Subfamily 1, Group D, Member 2 (NR1D2) (N-Term) antibody: This is a rabbit polyclonal antibody against NR1D2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN309901
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9975,485643,353187,259241
Concentration: 1 mg/mL
Antigen: NR1D2
Clonality: Polyclonal
Sequence: YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSD TNGNPKNGDL
Molecular weight: 65 kDa
Entrez gene: 9975,485643,353187,259241

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave